PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G161100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 750aa    MW: 80271.6 Da    PI: 7.0434
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G161100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.85.1e-14450489241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Seita.9G161100.1.p 450 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 489
                         6899*********************************987 PP

2TCR50.63.7e-16535574140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Seita.9G161100.1.p 535 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 574
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13449490IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538450575IPR005172CRC domain
PfamPF036385.5E-10452487IPR005172CRC domain
SMARTSM011141.5E-14535576IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.5E-12537573IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MDPPESPPAG QPSFTDVSLY EDSPVFDFIN SLSPIATPKP LDSAQNGQLF KSSDLVPVSS  60
IFTSPQVNPQ KESKPGIRDG YIQLSQGLSP NCQRNQIGSS SCIELSGSPT IPSENCSPSE  120
DATILPSKWP QPIPLGSETL GDAKKQDTDG KADHSSDVGQ VKLSSTCYDQ NGVDQMESST  180
SGRKVQENEL AKQYNDDLAA CSLNHLISHS GTGNGVMSKS GLSLEAQQLS WNLRSDDETR  240
RIHKKKKFDG STGCYIQSAA DNAHVYCAGA TEGVATNHDP EMLPGVIQSQ LVSNEYFFDT  300
FKVPSDDMAL SEDQCGRLHR CSLFNEKVGA SDMSVQSGSN PHLANICGDN YLKPAGSPVY  360
ALPGIGLHLN AVASNSSNNM PFTINPPLQP EHNSPTTIVS CSETGLYSSE VYTRIHDDHS  420
SQKTMPNANE SCQESHKKKR RKLQNGDGDS CRRCSCKKSK CLKLYCACFA AKVYCSGFCS  480
CQGCLNNHTH EETVSCIRKR TESRNPLAFA PTVTRACDSG SDFGDNSNNT PASARHKRGC  540
NCRKSSCLKK YCECFQSGVG CSMSCRCESC KNSFGKREGV LLLATAKMEK GAKAKGTRST  600
EEKLAFDKQD VVGQSGDLPS TENLFATPSL GPCRSSILPP STCSEPPLST AGYSSRLHNS  660
QSPIKADVLL SYFDTCAAEM IVGDGSANIQ EVGSSCISSV KVVSPNKKRV SPLHTGTGLS  720
PIGRSGRKLV LKSIPSFPSL TGDADSEPH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1436440KKKRR
2436441KKKRRK
3437441KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982356.20.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLK4A7550.0K4A755_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147741921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-64Tesmin/TSO1-like CXC domain-containing protein